PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010532298.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 259aa    MW: 28254.7 Da    PI: 7.6284
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010532298.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding452.5e-14102146347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + ++ G+g+Wk I+r + k+Rt+ q+ s+ qky
   XP_010532298.1 102 PWTEEEHKLFLLGLQKAGKGDWKGISRNFVKTRTPAQVASHAQKY 146
                      7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.60595151IPR017930Myb domain
SuperFamilySSF466891.51E-1797152IPR009057Homeodomain-like
TIGRFAMsTIGR015576.9E-1798150IPR006447Myb domain, plants
SMARTSM007171.8E-899149IPR001005SANT/Myb domain
PfamPF002494.1E-11102146IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-10102145IPR009057Homeodomain-like
CDDcd001675.66E-9102147No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MADGDSSSSD ISGGGVGFGG ARKEIMLFGV RLVVDPMRKC VSLNNLSEYE QPEEMPKKIG  60
GEDGDGEQKN KVDIATGYAS ADDAVPISSS SGGNRERKRG IPWTEEEHKL FLLGLQKAGK  120
GDWKGISRNF VKTRTPAQVA SHAQKYFLRQ SNLNRRRRRS SLFDMTTETV KMPMEEHQLL  180
TQENSTAIPL LNPTHGPTSH WAPFNLNTDR NPGLSFPPIS LNLSLASPCL KDPSSNPSAF  240
EMMPRFSGGD SSSSIIDVA
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00149DAPTransfer from AT1G19000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010532298.10.0PREDICTED: transcription factor MYB1R1-like
SwissprotQ2V9B07e-61MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLE4MX294e-81E4MX29_EUTHA; mRNA, clone: RTFL01-16-O16
TrEMBLV4KXY14e-81V4KXY1_EUTSA; Uncharacterized protein
STRINGAT1G19000.15e-80(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24612669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19000.28e-75MYB_related family protein